Species : |
Porcine |
Source : |
E.coli |
Tag : |
His |
Description : |
The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Form : |
Lyophilized |
Bio-activity : |
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. |
AA Sequence : |
MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC with polyhistidine tag at the C-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : |
Please use within one month after protein reconstitution. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |