Active Human CCL19

Cat.No. : CCL19-110H
Product Overview : It is a synthetic Protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : MIP-3b is related to other b chemokines, possessing 20-30% sequence identity with other b proteins. MIP-3b has been mapped to the 9p13 chromosome. This differs from other b proteins which are mapped to chromosome 17. MIP-3b is expressed in a variety of lymphoid tissues. and is down-regulated by the anti-inflammatory cytokine IL-10. Synthetic MIP-3b is chemotactic for cultured human lymphocytes and is a unique functional ligand for CCR-7. The CCR-7 receptor has been previously referred to as the Epstein-Barr virus-induced gene 1 (EBI1). CCR-7 is a chemokine receptor which is expressed in various lymphoid tissues and activated B and T lymphocytes. EBI1 is strongly up-regulated in B cells infected with Epstein-Barr virus and T cells infected with herpesvirus 6 or 7.
Form : Lyophilized
Bio-activity : Activity measured by the protein's ability to chemoattract cultured human lymphocytes. ED50 for this activity is between 0.1 and 0.4 μg/ml
AA Sequence : GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR RSS
Applications : Activity Assay
Storage : Product should be stored at -20°C. Aliquot to avoid freeze/thaw cycles
Reconstitution : Recommended reconstitution in sterile phosphate buffered saline which contains at least 0.1% human or bovine serum albumin to prepare a stocksolution of no less than 20 μg/ml and vortex thoroughly.
Gene Name CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ]
Official Symbol CCL19
Synonyms CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433;
Gene ID 6363
mRNA Refseq NM_006274
Protein Refseq NP_006265
MIM 602227
UniProt ID Q99731
Chromosome Location 9p13
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem;
Function CCR chemokine receptor binding; CCR10 chemokine receptor binding; CCR7 chemokine receptor binding; chemokine activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL19 Products

Required fields are marked with *

My Review for All CCL19 Products

Required fields are marked with *

0
cart-icon