Active Human CCL19
Cat.No. : | CCL19-110H |
Product Overview : | It is a synthetic Protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | MIP-3b is related to other b chemokines, possessing 20-30% sequence identity with other b proteins. MIP-3b has been mapped to the 9p13 chromosome. This differs from other b proteins which are mapped to chromosome 17. MIP-3b is expressed in a variety of lymphoid tissues. and is down-regulated by the anti-inflammatory cytokine IL-10. Synthetic MIP-3b is chemotactic for cultured human lymphocytes and is a unique functional ligand for CCR-7. The CCR-7 receptor has been previously referred to as the Epstein-Barr virus-induced gene 1 (EBI1). CCR-7 is a chemokine receptor which is expressed in various lymphoid tissues and activated B and T lymphocytes. EBI1 is strongly up-regulated in B cells infected with Epstein-Barr virus and T cells infected with herpesvirus 6 or 7. |
Form : | Lyophilized |
Bio-activity : | Activity measured by the protein's ability to chemoattract cultured human lymphocytes. ED50 for this activity is between 0.1 and 0.4 μg/ml |
AA Sequence : | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR RSS |
Applications : | Activity Assay |
Storage : | Product should be stored at -20°C. Aliquot to avoid freeze/thaw cycles |
Reconstitution : | Recommended reconstitution in sterile phosphate buffered saline which contains at least 0.1% human or bovine serum albumin to prepare a stocksolution of no less than 20 μg/ml and vortex thoroughly. |
Gene Name | CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ] |
Official Symbol | CCL19 |
Synonyms | CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433; |
Gene ID | 6363 |
mRNA Refseq | NM_006274 |
Protein Refseq | NP_006265 |
MIM | 602227 |
UniProt ID | Q99731 |
Chromosome Location | 9p13 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem; |
Function | CCR chemokine receptor binding; CCR10 chemokine receptor binding; CCR7 chemokine receptor binding; chemokine activity; |
◆ Recombinant Proteins | ||
CCL19-4399M | Recombinant Monkey CCL19 Protein | +Inquiry |
Ccl19-022C | Active Recombinant Mouse Ccl19 Protein (83 aa) | +Inquiry |
CCL19-119C | Recombinant Cynomolgus Monkey CCL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl19-722M | Recombinant Mouse Ccl19 protein, His-tagged | +Inquiry |
CCL19-2936HF | Recombinant Full Length Human CCL19 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL19 Products
Required fields are marked with *
My Review for All CCL19 Products
Required fields are marked with *