Active Recombinant Bovine TNF Protein

Cat.No. : TNF-20B
Product Overview : Recombinant Bovine TNF-alpha (78-234aa, 158aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Protein Length : 78-234
Description : Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation (By similarity).

Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance.
Form : Liquid
Bio-activity : Measured in a cytotoxicity assay using L929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D. The ED50 range ≤ 15 ng/mL.
Molecular Mass : 17.5 kDa
AA Sequence : MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name TNF tumor necrosis factor [ Bos taurus (cattle) ]
Official Symbol TNF
Synonyms TNF; tumor necrosis factor; TNFa; TNF-a; TNF-alpha; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor ligand superfamily member 2
Gene ID 280943
mRNA Refseq NM_173966
Protein Refseq NP_776391
UniProt ID Q06599

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNF Products

Required fields are marked with *

My Review for All TNF Products

Required fields are marked with *

0
cart-icon
0
compare icon