| Species : |
HPV |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-98 aa |
| Description : |
HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. |
| Form : |
Lyophilized from 0.22 μm filtered solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or PBS, 6% Trehalose, pH 7.4 or 50 mM Tris-HCl, 200 mM NaCl, pH 8.0 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 8% trehalose. |
| Bio-activity : |
Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is ≤0.3071 μg/mL. |
| Molecular Mass : |
Approximately 18-21 kDa |
| AASequence : |
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
> 94% as determined by reducing SDS-PAGE. |
| Storage : |
Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage. |
| Shipping : |
Room temperature in continental US; may vary elsewhere. |
| Reconstitution : |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose). |
