Active Recombinant Full Length Human S100A9 Protein, C-Flag-tagged
Cat.No. : | S100A9-12HFL |
Product Overview : | Recombinant Full Length Human S100A9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 13.1 kDa |
AA Sequence : | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | S100A9 S100 calcium binding protein A9 [ Homo sapiens (human) ] |
Official Symbol | S100A9 |
Synonyms | MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387; S100-A9 |
Gene ID | 6280 |
mRNA Refseq | NM_002965.4 |
Protein Refseq | NP_002956.1 |
MIM | 123886 |
UniProt ID | P06702 |
◆ Recombinant Proteins | ||
S100A9-4875R | Recombinant Rat S100A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A9-301159H | Recombinant Human S100A9 protein, GST-tagged | +Inquiry |
S100A9-0051c | Recombinant Human S100A9 Protein | +Inquiry |
S100A9-2369H | Recombinant Full Length Human S100 Calcium Binding Protein A9, His-tagged | +Inquiry |
S100A9-2215H | Active Recombinant Human S100A9, His tagged | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A9 Products
Required fields are marked with *
My Review for All S100A9 Products
Required fields are marked with *
0
Inquiry Basket