Active Recombinant Full Length Human AADAT Protein, C-Flag-tagged

Cat.No. : AADAT-570HFL
Product Overview : Recombinant Full Length Human AADAT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : The specific activity of KATII was determined by measuring the product Kynurenic acid formation from a conversion of Kynurenine. The reaction was carried out at 37 centigrade for 15min in the buffer containing PBS, pH7.4, 2mM a-oxoglutarate, 40µM PLP (pyridoxal 5'-phosphate), and 0.5mM kynurenine as the substrate.
Molecular Mass : 47.2 kDa
AA Sequence : MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism
Full Length : Full L.
Gene Name AADAT aminoadipate aminotransferase [ Homo sapiens (human) ]
Official Symbol AADAT
Synonyms KAT2; KATII; KYAT2
Gene ID 51166
mRNA Refseq NM_016228.4
Protein Refseq NP_057312.1
MIM 611754
UniProt ID Q8N5Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AADAT Products

Required fields are marked with *

My Review for All AADAT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon