Active Recombinant Full Length Human BCL2L1 Protein, C-Flag-tagged
Cat.No. : | BCL2L1-287HFL |
Product Overview : | Recombinant Full Length Human BCL2L1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro ubiquitination assay substrate |
Molecular Mass : | 25.9 kDa |
AA Sequence : | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF NRWFLTGMTVAGVVLLGSLFSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | BCL2L1 BCL2 like 1 [ Homo sapiens (human) ] |
Official Symbol | BCL2L1 |
Synonyms | BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S |
Gene ID | 598 |
mRNA Refseq | NM_138578.3 |
Protein Refseq | NP_612815.1 |
MIM | 600039 |
UniProt ID | Q07817 |
◆ Recombinant Proteins | ||
BCL2L1-616R | Recombinant Rat BCL2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Bcl2l1-544M | Recombinant Mouse Bcl2l1 protein | +Inquiry |
BCL2L1-2581H | Recombinant Human BCL2L1 protein, His-SUMO-tagged | +Inquiry |
BCL2L1-3321H | Recombinant Human BCL2L1 Protein | +Inquiry |
BCL2L1-439H | Recombinant Human BCL2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L1-8489HCL | Recombinant Human BCL2L1 293 Cell Lysate | +Inquiry |
BCL2L1-8488HCL | Recombinant Human BCL2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L1 Products
Required fields are marked with *
My Review for All BCL2L1 Products
Required fields are marked with *
0
Inquiry Basket