| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
2-261 aa |
| Description : |
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. |
| Form : |
Solution. Supplied as a 0.22 μm filter solution of 12.5 mM Tris-HCl, 75 mM NaCl, pH 7.5. |
| Bio-activity : |
The esterase activity is determined to be greater than 24 pmol/min/μg. |
| AASequence : |
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASFHHHHHH |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
≥ 95 %, as determined by reducing SDS-PAGE. |
| Storage : |
Stored at -80 centigrade for 1 year from date of receipt. It is stable at -20 centigrade for 3 months after opening. It is recommended to freeze aliquots at -80 centigrade for extended storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
2.00 mg/mL |
| Shipping : |
Shipping with dry ice. |
