Recombinant Human CA1 protein(11-260 aa), C-His-tagged
Cat.No. : | CA1-2503H |
Product Overview : | Recombinant Human CA1 protein(P00915)(11-260 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-260 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 30 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRAS |
Gene Name | CA1 carbonic anhydrase I [ Homo sapiens ] |
Official Symbol | CA1 |
Synonyms | CA1; carbonic anhydrase I; carbonic anhydrase 1; Car1; carbonic anhydrase B; carbonic dehydratase; carbonate dehydratase I; CAB; CA-I; |
Gene ID | 759 |
mRNA Refseq | NM_001128829 |
Protein Refseq | NP_001122301 |
MIM | 114800 |
UniProt ID | P00915 |
◆ Recombinant Proteins | ||
CA1-179H | Recombinant Human Carbonic Anhydrase I | +Inquiry |
CA1-2503H | Recombinant Human CA1 protein(11-260 aa), C-His-tagged | +Inquiry |
CA1-0468H | Recombinant Human CA1 Protein (Ala2-Phe261), N-His-tagged | +Inquiry |
CA1-2731HF | Recombinant Full Length Human CA1 Protein, GST-tagged | +Inquiry |
CAR1-2711M | Recombinant Mouse CAR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA1-7917HCL | Recombinant Human CA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA1 Products
Required fields are marked with *
My Review for All CA1 Products
Required fields are marked with *
0
Inquiry Basket