Active Recombinant Full Length Human CD33 Protein, C-Flag-tagged
Cat.No. : | CD33-139HFL |
Product Overview : | Recombinant Full Length Human CD33 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Association in cell culture |
Molecular Mass : | 38 kDa |
AA Sequence : | MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP SKDTSTEYSEVRTQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Hematopoietic cell lineage |
Full Length : | Full L. |
Gene Name | CD33 CD33 molecule [ Homo sapiens (human) ] |
Official Symbol | CD33 |
Synonyms | p67; SIGLEC3; SIGLEC-3 |
Gene ID | 945 |
mRNA Refseq | NM_001772.4 |
Protein Refseq | NP_001763.3 |
MIM | 159590 |
UniProt ID | P20138 |
◆ Recombinant Proteins | ||
CD33-4673H | Active Recombinant Human CD33 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
CD33-265H | Recombinant Human CD33 molecule Protein, Tag Free | +Inquiry |
CD33-342H | Active Recombinant Human CD33 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
CD33-459HP | Recombinant Human CD33 protein, Fc-tagged, R-PE labeled | +Inquiry |
CD33-267H | Recombinant Human CD33 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
CD33-978HCL | Recombinant Human CD33 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *
0
Inquiry Basket