Active Recombinant Full Length Human CHRDL2 Protein, C-Flag-tagged
Cat.No. : | CHRDL2-512HFL |
Product Overview : | Recombinant Full Length Human CHRDL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the chordin family of proteins. Chordin family members are secreted proteins that share a cysteine-rich pro-collagen repeat domain and associate with members of the transforming growth factor beta superfamily. In vitro assays demonstrate a direct interaction between the encoded protein and human activin A. This gene is expressed in many tissues including osteoblasts, where it is differentially expressed during differentiation. In addition, its expression is upregulated in human osteoarthritic joint cartilage, suggesting a role in adult cartilage regeneration. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVS CYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL CSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRG PGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILC TCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDN LRRFALEHEASDLVEIYLWKLVKDEETEAQRGEVPGPRPHSQNLPLDSDQESQEARLPERGTALPTARWP PRRSLERLPSPDPGAEGHGQSRQSDQDITKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | CHRDL2 chordin like 2 [ Homo sapiens (human) ] |
Official Symbol | CHRDL2 |
Synonyms | BNF1; CHL2 |
Gene ID | 25884 |
mRNA Refseq | NM_015424.6 |
Protein Refseq | NP_056239.3 |
MIM | 613127 |
UniProt ID | Q6WN34 |
◆ Recombinant Proteins | ||
CHRDL2-3227H | Recombinant Human CHRDL2 Protein, MYC/DDK-tagged | +Inquiry |
Chrdl2-6402M | Recombinant Mouse Chrdl2 Protein (Gln24-Leu426), C-His tagged | +Inquiry |
CHRDL2-1657M | Recombinant Mouse CHRDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRDL2-603H | Recombinant Human CHRDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRDL2-7164Z | Recombinant Zebrafish CHRDL2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRDL2 Products
Required fields are marked with *
My Review for All CHRDL2 Products
Required fields are marked with *