Active Recombinant Full Length Human CLU Protein, C-Flag-tagged
Cat.No. : | CLU-273HFL |
Product Overview : | Recombinant Full Length Human CLU Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Probe target |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGMMKTLLLFVGLLLTWESG QVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNET RESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDR IDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRS LMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRM KDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNW VSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKA LQEYRKKHREESGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | CLU clusterin [ Homo sapiens (human) ] |
Official Symbol | CLU |
Synonyms | CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2 |
Gene ID | 1191 |
mRNA Refseq | NM_001831.4 |
Protein Refseq | NP_001822.3 |
MIM | 185430 |
UniProt ID | P10909 |
◆ Recombinant Proteins | ||
CLU-1746H | Recombinant Human CLU Protein (Ser228-Glu449), N-His tagged | +Inquiry |
CLU-2640H | Recombinant Human CLU protein, His-tagged | +Inquiry |
CLU-106H | Recombinant Human CLU, Flag-tagged | +Inquiry |
Clu-108R | Recombinant Rattus Clusterin, His-tagged, T7-tagged | +Inquiry |
CLU-1742H | Recombinant Human CLU Protein (Asp23-Glu449), C-Fc and His tagged | +Inquiry |
◆ Native Proteins | ||
CLU-67H | Native Human Clusterin | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *
0
Inquiry Basket