Active Recombinant Full Length Human CMPK1 Protein, C-Flag-tagged
Cat.No. : | CMPK1-639HFL |
Product Overview : | Recombinant Full Length Human CMPK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MLSRCRSRLLHVLGLSFLLQTRRPILLCSPRLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELL RDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTM DGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDAS KSVDEVFDEVVQIFDKEGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | CMPK1 cytidine/uridine monophosphate kinase 1 [ Homo sapiens (human) ] |
Official Symbol | CMPK1 |
Synonyms | CK; CMK; UMK; CMPK; UMPK; UMP-CMPK |
Gene ID | 51727 |
mRNA Refseq | NM_016308.3 |
Protein Refseq | NP_057392.1 |
MIM | 191710 |
UniProt ID | P30085 |
◆ Recombinant Proteins | ||
CMPK1-1786M | Recombinant Mouse CMPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMPK1-2014M | Recombinant Mouse CMPK1 Protein (1-196 aa), His-SUMO-tagged | +Inquiry |
CMPK1-929R | Recombinant Rhesus monkey CMPK1 Protein, His-tagged | +Inquiry |
CMPK1-11365H | Recombinant Human CMPK1 protein, GST-tagged | +Inquiry |
CMPK1-3206C | Recombinant Chicken CMPK1 | +Inquiry |
◆ Native Proteins | ||
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMPK1-001HCL | Recombinant Human CMPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMPK1 Products
Required fields are marked with *
My Review for All CMPK1 Products
Required fields are marked with *