Recombinant Human CMPK1 Protein, GST-tagged
Cat.No. : | CMPK1-1541H |
Product Overview : | Human CMPK partial ORF ( NP_057392, 72 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Feb 2012] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMPK1 cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [ Homo sapiens ] |
Official Symbol | CMPK1 |
Synonyms | CMPK1; cytidine monophosphate (UMP-CMP) kinase 1, cytosolic; CMPK, cytidylate kinase; UMP-CMP kinase; Cytidine monophosphate kinase; UMP CMP kinase; UMP CMPK; UMP/CMP kinase; cytidylate kinase; deoxycytidylate kinase; uridine monophosphate kinase; uridine monophosphate/cytidine monophosphate kinase; CMK; UMK; CMPK; UMPK; UMP-CMPK; RP11-511I2.1; |
Gene ID | 51727 |
mRNA Refseq | NM_001136140 |
Protein Refseq | NP_001129612 |
MIM | 191710 |
UniProt ID | P30085 |
◆ Recombinant Proteins | ||
CMPK1-0267H | Recombinant Human CMPK1 Protein (M1-G196), His tagged | +Inquiry |
Cmpk1-2208M | Recombinant Mouse Cmpk1 Protein, Myc/DDK-tagged | +Inquiry |
CMPK1-1541H | Recombinant Human CMPK1 Protein, GST-tagged | +Inquiry |
CMPK1-833H | Recombinant Human CMPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CMPK1-3629M | Recombinant Mouse CMPK1 Protein | +Inquiry |
◆ Native Proteins | ||
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMPK1-001HCL | Recombinant Human CMPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMPK1 Products
Required fields are marked with *
My Review for All CMPK1 Products
Required fields are marked with *
0
Inquiry Basket