Recombinant Human CMPK1 Protein, GST-tagged
| Cat.No. : | CMPK1-1541H |
| Product Overview : | Human CMPK partial ORF ( NP_057392, 72 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Feb 2012] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CMPK1 cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [ Homo sapiens ] |
| Official Symbol | CMPK1 |
| Synonyms | CMPK1; cytidine monophosphate (UMP-CMP) kinase 1, cytosolic; CMPK, cytidylate kinase; UMP-CMP kinase; Cytidine monophosphate kinase; UMP CMP kinase; UMP CMPK; UMP/CMP kinase; cytidylate kinase; deoxycytidylate kinase; uridine monophosphate kinase; uridine monophosphate/cytidine monophosphate kinase; CMK; UMK; CMPK; UMPK; UMP-CMPK; RP11-511I2.1; |
| Gene ID | 51727 |
| mRNA Refseq | NM_001136140 |
| Protein Refseq | NP_001129612 |
| MIM | 191710 |
| UniProt ID | P30085 |
| ◆ Recombinant Proteins | ||
| CMPK1-3274H | Recombinant Human CMPK1 Protein, MYC/DDK-tagged | +Inquiry |
| CMPK1-1786M | Recombinant Mouse CMPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cmpk1-2208M | Recombinant Mouse Cmpk1 Protein, Myc/DDK-tagged | +Inquiry |
| CMPK1-1138R | Recombinant Rat CMPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CMPK1-1541H | Recombinant Human CMPK1 Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CMPK1-001HCL | Recombinant Human CMPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMPK1 Products
Required fields are marked with *
My Review for All CMPK1 Products
Required fields are marked with *



