Recombinant Human CMPK1 Protein, GST-tagged

Cat.No. : CMPK1-1541H
Product Overview : Human CMPK partial ORF ( NP_057392, 72 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Feb 2012]
Molecular Mass : 37.84 kDa
AA Sequence : DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMPK1 cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [ Homo sapiens ]
Official Symbol CMPK1
Synonyms CMPK1; cytidine monophosphate (UMP-CMP) kinase 1, cytosolic; CMPK, cytidylate kinase; UMP-CMP kinase; Cytidine monophosphate kinase; UMP CMP kinase; UMP CMPK; UMP/CMP kinase; cytidylate kinase; deoxycytidylate kinase; uridine monophosphate kinase; uridine monophosphate/cytidine monophosphate kinase; CMK; UMK; CMPK; UMPK; UMP-CMPK; RP11-511I2.1;
Gene ID 51727
mRNA Refseq NM_001136140
Protein Refseq NP_001129612
MIM 191710
UniProt ID P30085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMPK1 Products

Required fields are marked with *

My Review for All CMPK1 Products

Required fields are marked with *

0
cart-icon