Recombinant Human CMPK1 Protein, GST-tagged

• Cat.No.: CMPK1-1541H
• Product Overview: Human CMPK partial ORF ( NP_057392, 72 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of the enzymes required for cellular nucleic acid biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Feb 2012]
• Molecular Mass: 37.84 kDa
• AA Sequence: DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMPK1 cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [ Homo sapiens ]
• Official Symbol: CMPK1
• Synonyms: CMPK1; cytidine monophosphate (UMP-CMP) kinase 1, cytosolic; CMPK, cytidylate kinase; UMP-CMP kinase; Cytidine monophosphate kinase; UMP CMP kinase; UMP CMPK; UMP/CMP kinase; cytidylate kinase; deoxycytidylate kinase; uridine monophosphate kinase; uridine monophosphate/cytidine monophosphate kinase; CMK; UMK; CMPK; UMPK; UMP-CMPK; RP11-511I2.1
• Gene ID: 51727
• mRNA Refseq: NM_001136140
• Protein Refseq: NP_001129612
• MIM: 191710
• UniProt ID: P30085