Active Recombinant Full Length Human CSK Protein, C-Flag-tagged
Cat.No. : | CSK-657HFL |
Product Overview : | Recombinant Full Length Human CSK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | CSK activity verified in a biochemical assay: CSK (c-src tyrosine kinase) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. CSK is a tyrosine kinase known to phosphorylate LCK, FYN and LYN. Varying concentrations of CSK were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the tyrosine residue in the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK NCWHLDAAMRPSFLQLREQLEHIKTHELHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | CSK C-terminal Src kinase [ Homo sapiens (human) ] |
Official Symbol | CSK |
Synonyms | MGC117393 |
Gene ID | 1445 |
mRNA Refseq | NM_004383.3 |
Protein Refseq | NP_004374.1 |
MIM | 124095 |
UniProt ID | P41240 |
◆ Recombinant Proteins | ||
CSK-0765H | Recombinant Human CSK Protein (M1-L450), GST tagged | +Inquiry |
CSK-6272H | Recombinant Human CSK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSK-1628R | Recombinant Rat CSK Protein | +Inquiry |
CSK-3345H | Recombinant Human CSK Protein, MYC/DDK-tagged | +Inquiry |
CSK-342H | Active Recombinant Human CSK Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CSK-27872TH | Native Human CSK | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSK-001MCL | Recombinant Mouse CSK cell lysate | +Inquiry |
CSK-628HCL | Recombinant Human CSK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSK Products
Required fields are marked with *
My Review for All CSK Products
Required fields are marked with *
0
Inquiry Basket