Active Recombinant Full Length Human deoxycytidine kinase Protein, His tagged

Cat.No. : DCK-06HFL
Product Overview : Recombinant full length (aa 1-260) Human Deoxycytidine kinase (dCK) variant (R104M, D133A) purified by nickel-sepharose chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-260 aa
Description : Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.
Tag : N-His
Molecular Mass : ~31 kDa
AA Sequence : MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLS(R> M)IRAQLASLNGKLKDAEKPVLFFERSVYS(D> A)RYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Bio-activity : 145 IU/mg protein; kcat 1.22/sec with dC as substrate; One unit of WT human dCK converts 1.0 μmole of dC and ATP to dCMP and ADP per minute at pH 7.5 at 37 centigrade, as measured by a coupled enzyme system with 200 μM dC and 1 mM ATP.
Purity : > 99% (SDS-PAGE)
Storage : At -80 centigrade.
Storage Buffer : 25 mM Tris pH7.5, 500 mM NaCl, 20 % glycerol, 10 mM DTT, 1 mM EDTA
Concentration : 4.8 mg/mL
Shipping : Dry ice.
Reference : 1. Sabini E, Ort S, Monnerjahn C, Konrad M, Lavie A. Structure of human dCK suggests strategies to improve anticancer and antiviral therapy. Nat Struct Biol. 2003 Jul;10(7):513-9.Hazra S, Sabini E, Ort S, Konrad M, Lavie A.
2. Extending thymidine kinase activity to the catalytic repertoire of human deoxycytidine kinase. Biochemistry. 2009 Feb 17;48(6):1256-63. doi: 10.1021/bi802062w.
3. Neschadim A, Wang JC, Sato T, Fowler DH, Lavie A, Medin JA. Cell fate control gene therapy based on engineered variants of human deoxycytidine kinase. Mol Ther. 2012 May;20(5):1002-13. doi: 10.1038/mt.2011.298. Epub 2012 Jan 24.
Gene Name DCK deoxycytidine kinase [ Homo sapiens (human) ]
Official Symbol DCK
Synonyms DCK; deoxycytidine kinase; deoxycytidine kinase; deoxyadenosine kinase; deoxyguanosine kinase; deoxynucleoside kinase; EC 2.7.1.113; EC 2.7.1.74; EC 2.7.1.76
Gene ID 1633
mRNA Refseq NM_000788
Protein Refseq NP_000779
MIM 125450
UniProt ID P27707

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCK Products

Required fields are marked with *

My Review for All DCK Products

Required fields are marked with *

0
cart-icon
0
compare icon