Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged
Cat.No. : | EEF1B2-460HFL |
Product Overview : | Recombinant Full Length Human EEF1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Biolayer interferometry (BLI) assay |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF EDYVQSMDVAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ] |
Official Symbol | EEF1B2 |
Synonyms | EF1B; EEF1B; EEF1B1 |
Gene ID | 1933 |
mRNA Refseq | NM_001959.4 |
Protein Refseq | NP_001950.1 |
MIM | 600655 |
UniProt ID | P24534 |
◆ Recombinant Proteins | ||
EEF1B2-5000M | Recombinant Mouse EEF1B2 Protein | +Inquiry |
EEF1B2-460HFL | Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged | +Inquiry |
EEF1B2-224C | Recombinant Cynomolgus Monkey EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1B2-10315Z | Recombinant Zebrafish EEF1B2 | +Inquiry |
EEF1B2-12290H | Recombinant Human EEF1B2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *