Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged

Cat.No. : EEF1B2-460HFL
Product Overview : Recombinant Full Length Human EEF1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Biolayer interferometry (BLI) assay
Molecular Mass : 24.6 kDa
AA Sequence : MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
EDYVQSMDVAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ]
Official Symbol EEF1B2
Synonyms EF1B; EEF1B; EEF1B1
Gene ID 1933
mRNA Refseq NM_001959.4
Protein Refseq NP_001950.1
MIM 600655
UniProt ID P24534

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEF1B2 Products

Required fields are marked with *

My Review for All EEF1B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon