Active Recombinant Full Length Human EEF1D Protein, C-Flag-tagged
Cat.No. : | EEF1D-537HFL |
Product Overview : | Recombinant Full Length Human EEF1D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Biolayer interferometry (BLI) assay |
Molecular Mass : | 30.9 kDa |
AA Sequence : | MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGS RRDPRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPP ALAPWGLCTHGNQVACHHVTWGIWVNKSSFDQAERAFVEWSQALLLAPEGSRRQGTPNTGQQVAVPDLAH QPSPPVNGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERAGLAEGARRGRRDRRG RNILGNKRAGLRRADGEAPSALPYCYFLQKDAEAPWLSKPAYDSAECRHHAAEALRVAWCLEAASLSHRP GPRSGLSVSSLRPNRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARAR ENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRA TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEIT KFEEHVQSVDIAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EEF1D eukaryotic translation elongation factor 1 delta [ Homo sapiens (human) ] |
Official Symbol | EEF1D |
Synonyms | EF1D; EF-1D; FP1047 |
Gene ID | 1936 |
mRNA Refseq | NM_001960.7 |
Protein Refseq | NP_001951.2 |
MIM | 130592 |
UniProt ID | P29692 |
◆ Recombinant Proteins | ||
EEF1D-4208HF | Recombinant Full Length Human EEF1D Protein, GST-tagged | +Inquiry |
EEF1D-2015R | Recombinant Rat EEF1D Protein | +Inquiry |
Eef1d-1396M | Recombinant Mouse Eef1d protein, His & T7-tagged | +Inquiry |
EEF1D-805H | Recombinant Human EEF1D Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1D-2648M | Recombinant Mouse EEF1D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1D-531HCL | Recombinant Human EEF1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1D Products
Required fields are marked with *
My Review for All EEF1D Products
Required fields are marked with *
0
Inquiry Basket