Active Recombinant Full Length Human EGLN2 Protein, C-Flag-tagged
Cat.No. : | EGLN2-174HFL |
Product Overview : | Recombinant Full Length Human EGLN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity (In vitro hydroxylation assay) |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Pathways in cancer, Renal cell carcinoma |
Full Length : | Full L. |
Gene Name | EGLN2 egl-9 family hypoxia inducible factor 2 [ Homo sapiens (human) ] |
Official Symbol | EGLN2 |
Synonyms | EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1 |
Gene ID | 112398 |
mRNA Refseq | NM_053046.4 |
Protein Refseq | NP_444274.1 |
MIM | 606424 |
UniProt ID | Q96KS0 |
◆ Recombinant Proteins | ||
EGLN2-2840H | Recombinant Human EGLN2 protein, His-tagged | +Inquiry |
EGLN2-2030R | Recombinant Rat EGLN2 Protein | +Inquiry |
EGLN2-450H | Recombinant Human EGLN2 Protein, His-tagged | +Inquiry |
EGLN2-4260HF | Recombinant Full Length Human EGLN2 Protein, GST-tagged | +Inquiry |
EGLN2-3118H | Recombinant Human EGLN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN2-6694HCL | Recombinant Human EGLN2 293 Cell Lysate | +Inquiry |
EGLN2-6695HCL | Recombinant Human EGLN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGLN2 Products
Required fields are marked with *
My Review for All EGLN2 Products
Required fields are marked with *
0
Inquiry Basket