Active Recombinant Full Length Human ELK1 Protein (M1-P428), N-GST/6×His tagged
Cat.No. : | ELK1-6923H |
Product Overview : | Human ELK1, full length, amino acids (M1-P428, as in NCBI/Protein entry NP_005220.2), N-GST/6×His fusion protein with a 3C cleavage site, expressed in Sf9 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Sf9 Cells |
Tag : | GST&His |
Protein Length : | M1-P428 |
Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. |
Molecular Mass : | 73163 Da |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRDSLEVLFQGPLAMDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP |
Applications : | ELK1 has been validated for use as substrate in radiometric in-vitro kinase activity assays. |
Storage : | At -80 centigrade For complete recovery, mix well and spin before use. Product must not be stored in diluted solutions, aliquots below 10μl are not advisable. Avoid repeated freeze-thaw cycles! |
Concentration : | 0.303 μg/μL (Bradford method using BSA as standard protein) |
Storage Buffer : | 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM DTT, 15 mM reduced glutathione, 20 % glycerol |
Gene Name | ELK1 ETS transcription factor ELK1 [ Homo sapiens (human) ] |
Official Symbol | ELK1 |
Synonyms | ELK1; ETS transcription factor ELK1; ETS domain-containing protein Elk-1; ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS-like gene 1; tyrosine kinase (ELK1) oncogene |
Gene ID | 2002 |
mRNA Refseq | NM_005229.4 |
Protein Refseq | NP_005220.2 |
MIM | 311040 |
UniProt ID | P19419 |
◆ Recombinant Proteins | ||
ELK1-6734H | Recombinant Human ELK1 protein, His-tagged | +Inquiry |
ELK1-235C | Recombinant Cynomolgus Monkey ELK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELK1-6923H | Active Recombinant Full Length Human ELK1 Protein (M1-P428), N-GST/6×His tagged | +Inquiry |
ELK1-5134M | Recombinant Mouse ELK1 Protein | +Inquiry |
ELK1-2738M | Recombinant Mouse ELK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK1 Products
Required fields are marked with *
My Review for All ELK1 Products
Required fields are marked with *