Active Recombinant Full Length Human ELK1 Protein (M1-P428), N-GST/6×His tagged

Cat.No. : ELK1-6923H
Product Overview : Human ELK1, full length, amino acids (M1-P428, as in NCBI/Protein entry NP_005220.2), N-GST/6×His fusion protein with a 3C cleavage site, expressed in Sf9 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Sf9 Cells
Tag : GST&His
Protein Length : M1-P428
Description : This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14.
Molecular Mass : 73163 Da
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRDSLEVLFQGPLAMDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Applications : ELK1 has been validated for use as substrate in radiometric in-vitro kinase activity assays.
Storage : At -80 centigrade
For complete recovery, mix well and spin before use. Product must not be stored in diluted solutions, aliquots below 10μl are not advisable. Avoid repeated freeze-thaw cycles!
Concentration : 0.303 μg/μL (Bradford method using BSA as standard protein)
Storage Buffer : 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM DTT, 15 mM reduced glutathione, 20 % glycerol
Gene Name ELK1 ETS transcription factor ELK1 [ Homo sapiens (human) ]
Official Symbol ELK1
Synonyms ELK1; ETS transcription factor ELK1; ETS domain-containing protein Elk-1; ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS-like gene 1; tyrosine kinase (ELK1) oncogene
Gene ID 2002
mRNA Refseq NM_005229.4
Protein Refseq NP_005220.2
MIM 311040
UniProt ID P19419

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELK1 Products

Required fields are marked with *

My Review for All ELK1 Products

Required fields are marked with *

0
cart-icon