Active Recombinant Full Length Human ERBB4 Protein, C-Flag-tagged
Cat.No. : | ERBB4-513HFL |
Product Overview : | Recombinant Full Length Human ERBB4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ErbB4 activity verified in a biochemical assay : ErbB4 (v-erb-a erythroblastic leukemia viral oncogene homolog 4) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. ErbB4 is a tyrosine protein kinase and a member of the epidermal growth factor receptor subfamily. Varying concentrations of ErbB4 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the tyrosine residue in the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 142.6 kDa |
AA Sequence : | MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH NRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS SNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN RKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCE KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTS HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTP SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVY RDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFA PERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEP LYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP IVAENPEYLSEFSLKPGTVLPPPPYRHRNTVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Calcium signaling pathway, Endocytosis, ErbB signaling pathway |
Full Length : | Full L. |
Gene Name | ERBB4 erb-b2 receptor tyrosine kinase 4 [ Homo sapiens (human) ] |
Official Symbol | ERBB4 |
Synonyms | HER4; ALS19; p180erbB4 |
Gene ID | 2066 |
mRNA Refseq | NM_001042599.1 |
Protein Refseq | NP_001036064.1 |
MIM | 600543 |
UniProt ID | Q15303 |
◆ Recombinant Proteins | ||
ERBB4-288H | Recombinant Human ERBB4, Fc-His tagged | +Inquiry |
ERBB4-329H | Recombinant Human ERBB4, GST-tagged, Active | +Inquiry |
Erbb4-971M | Recombinant Mouse Erbb4 Protein, MYC/DDK-tagged | +Inquiry |
Erbb4-7416MF | Active Recombinant Mouse Erbb4 Protein, His-tagged, FITC conjugated | +Inquiry |
ERBB4-2237C | Recombinant Chicken ERBB4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB4-1417MCL | Recombinant Mouse ERBB4 cell lysate | +Inquiry |
ERBB4-1543HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-001HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERBB4 Products
Required fields are marked with *
My Review for All ERBB4 Products
Required fields are marked with *
0
Inquiry Basket