Active Recombinant Full Length Human EWSR1 Protein, C-Flag-tagged
Cat.No. : | EWSR1-67HFL |
Product Overview : | Recombinant Full Length Human WAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Transmission electron microscopy In vitro kinase assay inhibitor |
Molecular Mass : | 68.3 kDa |
AA Sequence : | MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPP VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRG GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGG DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGG RRGGRGGPGKMDKGEHRQERRDRPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Full Length : | Full L. |
Gene Name | EWSR1 EWS RNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | EWSR1 |
Synonyms | EWS; EWS-FLI1; bK984G1.4 |
Gene ID | 2130 |
mRNA Refseq | NM_005243.4 |
Protein Refseq | NP_005234.1 |
MIM | 133450 |
UniProt ID | Q01844 |
◆ Recombinant Proteins | ||
EWSR1-245C | Recombinant Cynomolgus Monkey EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EWSR1-500C | Recombinant Cynomolgus EWSR1 Protein, His-tagged | +Inquiry |
EWSR1-876H | Recombinant Human EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ewsr1-985M | Recombinant Mouse Ewsr1 Protein, MYC/DDK-tagged | +Inquiry |
EWSR1-67HFL | Active Recombinant Full Length Human EWSR1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EWSR1 Products
Required fields are marked with *
My Review for All EWSR1 Products
Required fields are marked with *