Recombinant Human EWSR1 Protein, GST-tagged
| Cat.No. : | EWSR1-3553H |
| Product Overview : | Human EWSR1 partial ORF ( NP_005234, 358 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009] |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ] |
| Official Symbol | EWSR1 |
| Synonyms | EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4; |
| Gene ID | 2130 |
| mRNA Refseq | NM_001163285 |
| Protein Refseq | NP_001156757 |
| MIM | 133450 |
| UniProt ID | Q01844 |
| ◆ Recombinant Proteins | ||
| EWSR1-876H | Recombinant Human EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EWSR1-5364M | Recombinant Mouse EWSR1 Protein | +Inquiry |
| EWSR1-19H | Recombinant Human EWSR1 protein, His-tagged | +Inquiry |
| EWSR1-2890M | Recombinant Mouse EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EWSR1-67HFL | Active Recombinant Full Length Human EWSR1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EWSR1 Products
Required fields are marked with *
My Review for All EWSR1 Products
Required fields are marked with *
