Active Recombinant Full Length Human FCGRT Protein, C-Flag-tagged
Cat.No. : | FCGRT-135HFL |
Product Overview : | Recombinant Full Length Human FCGRT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | MS digestion standard |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA QDADLKDVNVIPATATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | FCGRT Fc gamma receptor and transporter [ Homo sapiens (human) ] |
Official Symbol | FCGRT |
Synonyms | FCRN; FcgammaRn; alpha-chain |
Gene ID | 2217 |
mRNA Refseq | NM_004107.5 |
Protein Refseq | NP_004098.1 |
MIM | 601437 |
UniProt ID | P55899 |
◆ Recombinant Proteins | ||
Fcgrt & B2m-1546M | Recombinant Mouse Fcgrt/B2m protein, His/Strep II/Avi-tagged, Biotinylated | +Inquiry |
FCGRT-1210H | Recombinant Human FCGRT Protein, GST-tagged | +Inquiry |
FCGRT-1963R | Recombinant Rat FCGRT Protein, His (Fc)-Avi-tagged | +Inquiry |
Fcgrt-291M | Active Recombinant Mouse Fcgrt, His-tagged | +Inquiry |
FCGRT & B2M-1929H | Recombinant Human FCGRT & B2M Protein, His & Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
0
Inquiry Basket