Active Recombinant Full Length Human HSPA1A Protein, C-Flag-tagged
Cat.No. : | HSPA1A-116HFL |
Product Overview : | Recombinant Full Length Human HSPA1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Higher specific activity than E. coli derived HSP70: Origene human recombinant Hsp70 (TP300270) was compared side-by-side with E. coli derived Hsp70 in a firefly luciferase refolding assay. Percentage of refolding is relative to an identical load of non-denatured luciferase in the reaction. The human cell produced Hsp70 is approximately 30% more active than the bacterial produced Hsp70. |
Molecular Mass : | 69.9 kDa |
AA Sequence : | MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDA KRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVT NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSIL TIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQA SLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKG KISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGG SGSGPTIEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Prion diseases, Spliceosome |
Full Length : | Full L. |
Gene Name | HSPA1A heat shock protein family A (Hsp70) member 1A [ Homo sapiens (human) ] |
Official Symbol | HSPA1A |
Synonyms | HSP70; HSP72; HSPA1; HSP70I; HSP70-1; HSP70-2; HSP70.1; HSP70.2; HSP70-1A; HEL-S-103 |
Gene ID | 3303 |
mRNA Refseq | NM_005345.6 |
Protein Refseq | NP_005336.3 |
MIM | 140550 |
UniProt ID | P0DMV8 |
◆ Recombinant Proteins | ||
HSPA1A-5402P | Recombinant Sumatran orangutan HSPA1A (Met1-Glu386, V59A, D69A, H89A, E231A, R261A) Protein, C-His tagged | +Inquiry |
HSPA1A-1481C | Recombinant Cattle HSPA1A protein, His-tagged | +Inquiry |
HSPA1A-2944R | Recombinant Rat HSPA1A protein, His-tagged | +Inquiry |
HSPA1A-066H | Active Recombinant Human HSPA1A Protein, His-tagged | +Inquiry |
Hspa1a-1638R | Recombinant Rat Hspa1a Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA1A-519HCL | Recombinant Human HSPA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA1A Products
Required fields are marked with *
My Review for All HSPA1A Products
Required fields are marked with *
0
Inquiry Basket