Active Recombinant Full Length Human ITGB2 Protein, C-Flag-tagged
Cat.No. : | ITGB2-248HFL |
Product Overview : | Recombinant Full Length Human ITGB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Far-Western blot ELISA binding assay |
Molecular Mass : | 82.5 kDa |
AA Sequence : | MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Viral myocarditis |
Full Length : | Full L. |
Gene Name | ITGB2 integrin subunit beta 2 [ Homo sapiens (human) ] |
Official Symbol | ITGB2 |
Synonyms | LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1 |
Gene ID | 3689 |
mRNA Refseq | NM_001127491.3 |
Protein Refseq | NP_001120963.2 |
MIM | 600065 |
UniProt ID | P05107 |
◆ Recombinant Proteins | ||
Itgb2-7146R | Recombinant Rat Itgb2 protein, His & T7-tagged | +Inquiry |
Itgb2-7145M | Recombinant Mouse Itgb2 protein, His & T7-tagged | +Inquiry |
ITGB2-26324TH | Recombinant Human ITGB2 | +Inquiry |
RFL20219MF | Recombinant Full Length Mouse Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
ITGB2-279HF | Recombinant Full Length Human ITGB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket