Active Recombinant Full Length Human JMJD6 Protein, C-Flag-tagged
Cat.No. : | JMJD6-301HFL |
Product Overview : | Recombinant Full Length Human JMJD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 46.3 kDa |
AA Sequence : | MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS |
Full Length : | Full L. |
Gene Name | JMJD6 jumonji domain containing 6, arginine demethylase and lysine hydroxylase [ Homo sapiens (human) ] |
Official Symbol | JMJD6 |
Synonyms | PSR; PTDSR; PTDSR1 |
Gene ID | 23210 |
mRNA Refseq | NM_015167.3 |
Protein Refseq | NP_055982.2 |
MIM | 604914 |
UniProt ID | Q6NYC1 |
◆ Recombinant Proteins | ||
JMJD6-8424M | Recombinant Mouse JMJD6 Protein | +Inquiry |
JMJD6-4745H | Recombinant Human JMJD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
JMJD6-1968H | Recombinant Human JMJD6 protein, His & T7-tagged | +Inquiry |
Jmjd6-349M | Recombinant Mouse Jmjd6 Protein, MYC/DDK-tagged | +Inquiry |
JMJD6-207H | Recombinant Human JMJD6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JMJD6-5101HCL | Recombinant Human JMJD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JMJD6 Products
Required fields are marked with *
My Review for All JMJD6 Products
Required fields are marked with *
0
Inquiry Basket