Active Recombinant Full Length Human KMO Protein, C-Flag-tagged
Cat.No. : | KMO-246HFL |
Product Overview : | Recombinant Full Length Human KMO Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | The specific activity of KMO was determined by measuring the product 3-hydroxykynurenine formation from a conversion of Kynurenine. The reaction was carried out at 37 centigrade for 40 min in the buffer containing 100 mM Tris, pH8.0, 10 mM KCl, 1 mM NADPH, 3 mM glucose-6-phos-phate, 1 units/ml of glucose-6 phosphate dehydrogenase, and 100 ?M kynurenine as the substrate Surface Plasmon Ressonance (SPR). |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK VINKGLFFLGSLIAISSTYLLIHYMSPRSFLCLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | KMO kynurenine 3-monooxygenase [ Homo sapiens (human) ] |
Official Symbol | KMO |
Synonyms | dJ317G22.1 |
Gene ID | 8564 |
mRNA Refseq | NM_003679.5 |
Protein Refseq | NP_003670.2 |
MIM | 603538 |
UniProt ID | O15229 |
◆ Cell & Tissue Lysates | ||
KMO-951HCL | Recombinant Human KMO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KMO Products
Required fields are marked with *
My Review for All KMO Products
Required fields are marked with *
0
Inquiry Basket