Active Recombinant Full Length Human KYAT1 Protein, C-Flag-tagged
| Cat.No. : | KYAT1-366HFL |
| Product Overview : | Recombinant Full Length Human KYAT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | The specific activity of KATI was determined by measuring the product Kynurenic acid formation from a conversion of Kynurenine. The reaction was carried out at 37? for 15min in the buffer containing 100 mM PBS, pH7.4, 2 mM a-oxoglutarate, 40µM PLP (pyridoxal 5'-phosphate), and 0.5 mM kynurenine as the substrate. |
| Molecular Mass : | 47.7 kDa |
| AA Sequence : | MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV ELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | KYAT1 kynurenine aminotransferase 1 [ Homo sapiens (human) ] |
| Official Symbol | KYAT1 |
| Synonyms | GTK; KAT1; KATI; CCBL1 |
| Gene ID | 883 |
| mRNA Refseq | NM_004059.5 |
| Protein Refseq | NP_004050.3 |
| MIM | 600547 |
| UniProt ID | Q16773 |
| ◆ Recombinant Proteins | ||
| KYAT1-1268H | Recombinant Human KYAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KYAT1-366HFL | Active Recombinant Full Length Human KYAT1 Protein, C-Flag-tagged | +Inquiry |
| KYAT1-1540H | Recombinant Human KYAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KYAT1-4376H | Recombinant Human KYAT1 protein, His-SUMO-tagged | +Inquiry |
| KYAT1-3717H | Recombinant Human KYAT1 Protein (Met1-Leu372), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KYAT1 Products
Required fields are marked with *
My Review for All KYAT1 Products
Required fields are marked with *




