| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Mammalian Cells | 
                                
                                
                                    | Tag : | 
                                    Flag | 
                                
                                
                                    | Description : | 
                                    This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. | 
                                
                                
                                    | Form : | 
                                    25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                
                                    | Bio-activity : | 
                                    The specific activity of KATI was determined by measuring the product Kynurenic acid formation from a conversion of Kynurenine. The reaction was carried out at 37? for 15min in the buffer containing 100 mM PBS, pH7.4, 2 mM a-oxoglutarate, 40µM PLP (pyridoxal 5'-phosphate), and 0.5 mM kynurenine as the substrate. | 
                                
                                
                                    | Molecular Mass : | 
                                    47.7 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV ELTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                
                                    | Purity : | 
                                    > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                
                                    | Stability : | 
                                    Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. | 
                                
                                
                                    | Concentration : | 
                                    >50 ug/mL as determined by microplate BCA method. | 
                                
                                
                                    | Preparation : | 
                                    Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                
                                    | Full Length : | 
                                    Full L. |