Active Recombinant Full Length Human MAVS Protein, C-Flag-tagged
Cat.No. : | MAVS-149HFL |
Product Overview : | Recombinant Full Length Human MAVS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral innate immunity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Surface Plasmon Ressonance (SPR) |
Molecular Mass : | 56.3 kDa |
AA Sequence : | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVE YFIAALRGCELVDLADEVASVYESYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSY PMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEKDTELGSTHTAGA TSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEP IICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLP INSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSFENRGLGSELSK PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPD GGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | MAVS mitochondrial antiviral signaling protein [ Homo sapiens (human) ] |
Official Symbol | MAVS |
Synonyms | IPS1; VISA; IPS-1; CARDIF |
Gene ID | 57506 |
mRNA Refseq | NM_020746.5 |
Protein Refseq | NP_065797.2 |
MIM | 609676 |
UniProt ID | Q7Z434 |
◆ Recombinant Proteins | ||
Mavs-3974M | Recombinant Mouse Mavs Protein, Myc/DDK-tagged | +Inquiry |
Mavs-380M | Recombinant Mouse Mavs Protein, His&GST-tagged | +Inquiry |
Mavs-381R | Recombinant Rat Mavs Protein, His&GST-tagged | +Inquiry |
MAVS-2509R | Recombinant Rhesus Macaque MAVS Protein, His (Fc)-Avi-tagged | +Inquiry |
MAVS-5622H | Recombinant Human MAVS protein, MBP&His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAVS-1909HCL | Recombinant Human MAVS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAVS Products
Required fields are marked with *
My Review for All MAVS Products
Required fields are marked with *
0
Inquiry Basket