Active Recombinant Full Length Human MIIP Protein, C-Flag-tagged

Cat.No. : MIIP-474HFL
Product Overview : Recombinant Full Length Human MIIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein that interacts with the oncogene protein insulin-like growth factor binding protein 2 and may function as an inhibitor of cell migration and invasion. This protein also interacts with the cell division protein 20 and may be involved in regulating mitotic progression. This protein may function as a tumor suppressor by inhibiting the growth or certain cancers.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Enzyme activity regulator
Molecular Mass : 42.6 kDa
AA Sequence : MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTSCPRGR SSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGRLGDPGPQEAQ TSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQPEAFFSKLQEFRETNK EECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAH VRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQK
LSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name MIIP migration and invasion inhibitory protein [ Homo sapiens (human) ]
Official Symbol MIIP
Synonyms IIP45
Gene ID 60672
mRNA Refseq NM_021933.4
Protein Refseq NP_068752.2
MIM 608772
UniProt ID Q5JXC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIIP Products

Required fields are marked with *

My Review for All MIIP Products

Required fields are marked with *

0
cart-icon
0
compare icon