Active Recombinant Full Length Human MIIP Protein, C-Flag-tagged
Cat.No. : | MIIP-474HFL |
Product Overview : | Recombinant Full Length Human MIIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that interacts with the oncogene protein insulin-like growth factor binding protein 2 and may function as an inhibitor of cell migration and invasion. This protein also interacts with the cell division protein 20 and may be involved in regulating mitotic progression. This protein may function as a tumor suppressor by inhibiting the growth or certain cancers. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity regulator |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTSCPRGR SSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGRLGDPGPQEAQ TSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQPEAFFSKLQEFRETNK EECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAH VRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQK LSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MIIP migration and invasion inhibitory protein [ Homo sapiens (human) ] |
Official Symbol | MIIP |
Synonyms | IIP45 |
Gene ID | 60672 |
mRNA Refseq | NM_021933.4 |
Protein Refseq | NP_068752.2 |
MIM | 608772 |
UniProt ID | Q5JXC2 |
◆ Recombinant Proteins | ||
MIIP-141H | Recombinant Human MIIP, His-tagged | +Inquiry |
MIIP-6601HF | Recombinant Full Length Human MIIP Protein, GST-tagged | +Inquiry |
MIIP-5560M | Recombinant Mouse MIIP Protein, His (Fc)-Avi-tagged | +Inquiry |
Miip-2442M | Recombinant Mouse Miip Protein, Myc/DDK-tagged | +Inquiry |
MIIP-5340H | Recombinant Human MIIP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIIP-4314HCL | Recombinant Human MIIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIIP Products
Required fields are marked with *
My Review for All MIIP Products
Required fields are marked with *
0
Inquiry Basket