Active Recombinant Full Length Human NEU4 Protein, C-Flag-tagged
Cat.No. : | NEU4-129HFL |
Product Overview : | Recombinant Full Length Human NEU4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to a family of glycohydrolytic enzymes, which remove terminal sialic acid residues from various sialo derivatives, such as glycoproteins, glycolipids, oligosaccharides, and gangliosides. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MMSSAAFPRWLSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRR GTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVA SRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSF AFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVAS LPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQ PRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTE PWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPR GCCWPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Other glycan degradation, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | NEU4 neuraminidase 4 [ Homo sapiens (human) ] |
Official Symbol | NEU4 |
Synonyms | FLJ35928; MGC18222; MGC102757 |
Gene ID | 129807 |
mRNA Refseq | NM_080741.4 |
Protein Refseq | NP_542779.2 |
MIM | 608527 |
UniProt ID | Q8WWR8 |
◆ Recombinant Proteins | ||
NEU4-6019M | Recombinant Mouse NEU4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32338MF | Recombinant Full Length Mouse Sialidase-4(Neu4) Protein, His-Tagged | +Inquiry |
NEU4-2737Z | Recombinant Zebrafish NEU4 | +Inquiry |
NEU4-4014H | Recombinant Human NEU4 Protein (Tyr22-Pro286), N-His tagged | +Inquiry |
Neu4-4381M | Recombinant Mouse Neu4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU4 Products
Required fields are marked with *
My Review for All NEU4 Products
Required fields are marked with *
0
Inquiry Basket