Active Recombinant Full Length Human NPY Protein

• Cat.No.: NPY-344HF
• Product Overview: Recombinant full length Human Neuropeptide Y with a proprietary tag; predicted MWt 36.74 kDa including the tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 97 amino acids
• Description: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases.
• Form: Liquid
• Bio-activity: Useful for Antibody Production and Protein Array
• Molecular Mass: 36.740kDa inclusive of tags
• AA Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: NPY neuropeptide Y [ Homo sapiens ]
• Official Symbol: NPY
• Synonyms: NPY; neuropeptide Y; pro-neuropeptide Y; PYY4
• Gene ID: 4852
• mRNA Refseq: NM_000905
• Protein Refseq: NP_000896
• MIM: 162640
• UniProt ID: P01303