Recombinant Human NPY Protein, GST-tagged
| Cat.No. : | NPY-6052H | 
| Product Overview : | Human NPY full-length ORF ( AAH29497, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014] | 
| Molecular Mass : | 36.41 kDa | 
| AA Sequence : | MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | NPY neuropeptide Y [ Homo sapiens ] | 
| Official Symbol | NPY | 
| Synonyms | NPY; neuropeptide Y; pro-neuropeptide Y; PYY4; | 
| Gene ID | 4852 | 
| mRNA Refseq | NM_000905 | 
| Protein Refseq | NP_000896 | 
| MIM | 162640 | 
| UniProt ID | P01303 | 
| ◆ Recombinant Proteins | ||
| NPY-4719H | Recombinant Human NPY Protein (Tyr29-Trp97), N-SUMO tagged | +Inquiry | 
| NPY-4718H | Recombinant Human NPY Protein (Tyr29-Trp97), N-His tagged | +Inquiry | 
| NPY-29247TH | Recombinant Human NPY | +Inquiry | 
| NPY-233H | Recombinant Human NPY protein, His-tagged | +Inquiry | 
| NPY-4767R | Recombinant Rabbit NPY protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NPY-3726HCL | Recombinant Human NPY 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NPY Products
Required fields are marked with *
My Review for All NPY Products
Required fields are marked with *
  
        
    
      
            