Active Recombinant Full Length Human OLR1 Protein, C-Flag-tagged
Cat.No. : | OLR1-693HFL |
Product Overview : | Recombinant Full Length Human OLR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Binding assay |
Molecular Mass : | 30.8 kDa |
AA Sequence : | MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | OLR1 oxidized low density lipoprotein receptor 1 [ Homo sapiens (human) ] |
Official Symbol | OLR1 |
Synonyms | LOX1; LOXIN; SLOX1; CLEC8A; SCARE1 |
Gene ID | 4973 |
mRNA Refseq | NM_002543.4 |
Protein Refseq | NP_002534.1 |
MIM | 602601 |
UniProt ID | P78380 |
◆ Recombinant Proteins | ||
OLR1-693HFL | Active Recombinant Full Length Human OLR1 Protein, C-Flag-tagged | +Inquiry |
OLR1-3306H | Recombinant Human OLR1 protein, His-tagged | +Inquiry |
OLR1-1579H | Recombinant Human OLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Olr1-559R | Recombinant Rat Olr1, His-tagged | +Inquiry |
OLR1-5099H | Recombinant Human OLR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLR1-1170CCL | Recombinant Cynomolgus OLR1 cell lysate | +Inquiry |
OLR1-001RCL | Recombinant Rat OLR1 cell lysate | +Inquiry |
OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OLR1 Products
Required fields are marked with *
My Review for All OLR1 Products
Required fields are marked with *
0
Inquiry Basket