Active Recombinant Full Length Human PPM1H Protein, C-Flag-tagged
| Cat.No. : | PPM1H-456HFL |
| Product Overview : | Recombinant Full Length Human PPM1H Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Dephosphorylates CDKN1B at 'Thr-187', thus removing a signal for proteasomal degradation. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | In vitro phosphatase assay |
| Molecular Mass : | 56.3 kDa |
| AA Sequence : | MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS NDRLGSGDDISVYVIPLIHGNKLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Phosphatase |
| Full Length : | Full L. |
| Gene Name | PPM1H protein phosphatase, Mg2+/Mn2+ dependent 1H [ Homo sapiens (human) ] |
| Official Symbol | PPM1H |
| Synonyms | URCC2; ARHCL1; NERPP-2C |
| Gene ID | 57460 |
| mRNA Refseq | NM_020700.2 |
| Protein Refseq | NP_065751.1 |
| MIM | 616016 |
| UniProt ID | Q9ULR3 |
| ◆ Recombinant Proteins | ||
| PPM1H-456HFL | Active Recombinant Full Length Human PPM1H Protein, C-Flag-tagged | +Inquiry |
| PPM1H-1746H | Recombinant Human PPM1H Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPM1H-4608R | Recombinant Rat PPM1H Protein | +Inquiry |
| PPM1H-4734Z | Recombinant Zebrafish PPM1H | +Inquiry |
| PPM1H-1507H | Recombinant Human PPM1H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPM1H Products
Required fields are marked with *
My Review for All PPM1H Products
Required fields are marked with *
