Active Recombinant Full Length Human PSME3IP1 Protein, C-Flag-tagged

• Cat.No.: PSME3IP1-540HFL
• Product Overview: Recombinant Full Length Human PSME3IP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in negative regulation of proteasomal protein catabolic process and negative regulation of protein binding activity. Located in nucleus.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Enzyme substrate
• Molecular Mass: 28.7 kDa
• AA Sequence: MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG
  ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: PSME3IP1 proteasome activator subunit 3 interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: PSME3IP1
• Synonyms: CDA10; NIP30; PIP30; CDA018; FAM192A; C16orf94
• Gene ID: 80011
• mRNA Refseq: NM_024946.4
• Protein Refseq: NP_079222.1
• MIM: 617766
• UniProt ID: Q9GZU8