Active Recombinant Full Length Human RAB5C Protein, C-Flag-tagged
Cat.No. : | RAB5C-714HFL |
Product Overview : | Recombinant Full Length Human RAB5C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR SQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB5C |
Synonyms | RABL; L1880; RAB5L; RAB5CL |
Gene ID | 5878 |
mRNA Refseq | NM_201434.3 |
Protein Refseq | NP_958842.1 |
MIM | 604037 |
UniProt ID | P51148 |
◆ Recombinant Proteins | ||
RAB5C-054H | Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB5C-6094C | Recombinant Chicken RAB5C | +Inquiry |
RAB5C-306H | Recombinant Human RAB5C Protein, MYC/DDK-tagged | +Inquiry |
RAB5C-532H | Recombinant Human RAB5C, member RAS oncogene family, His-tagged | +Inquiry |
RAB5C-1231H | Recombinant Human RAB5C protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *
0
Inquiry Basket