Active Recombinant Full Length Human RAB5C Protein, C-Flag-tagged

Cat.No. : RAB5C-714HFL
Product Overview : Recombinant Full Length Human RAB5C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Enzyme activity
Molecular Mass : 23.3 kDa
AA Sequence : MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
SQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Endocytosis
Full Length : Full L.
Gene Name RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB5C
Synonyms RABL; L1880; RAB5L; RAB5CL
Gene ID 5878
mRNA Refseq NM_201434.3
Protein Refseq NP_958842.1
MIM 604037
UniProt ID P51148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB5C Products

Required fields are marked with *

My Review for All RAB5C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon