Active Recombinant Full Length Human RXYLT1 Protein, C-Flag-tagged
| Cat.No. : | RXYLT1-539HFL |
| Product Overview : | Recombinant Full Length Human RXYLT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a type II transmembrane protein that is thought to have glycosyltransferase function. Mutations in this gene result in cobblestone lissencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Enzyme activity |
| Molecular Mass : | 51 kDa |
| AA Sequence : | MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH FKTELKMKFTNILESSFLMNNKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | RXYLT1 ribitol xylosyltransferase 1 [ Homo sapiens (human) ] |
| Official Symbol | RXYLT1 |
| Synonyms | TMEM5; HP10481; MDDGA10 |
| Gene ID | 10329 |
| mRNA Refseq | NM_014254.3 |
| Protein Refseq | NP_055069.1 |
| MIM | 605862 |
| UniProt ID | Q9Y2B1 |
| ◆ Recombinant Proteins | ||
| RXYLT1-5550H | Recombinant Human RXYLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RXYLT1-539HFL | Active Recombinant Full Length Human RXYLT1 Protein, C-Flag-tagged | +Inquiry |
| Rxylt1-5661M | Recombinant Mouse Rxylt1 Protein, Myc/DDK-tagged | +Inquiry |
| RXYLT1-1933H | Recombinant Human RXYLT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RXYLT1 Products
Required fields are marked with *
My Review for All RXYLT1 Products
Required fields are marked with *
