Active Recombinant Full Length Human SAE1 Protein, C-Flag-tagged
Cat.No. : | SAE1-436HFL |
Product Overview : | Recombinant Full Length Human SAE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | SAE1 SUMO1 activating enzyme subunit 1 [ Homo sapiens (human) ] |
Official Symbol | SAE1 |
Synonyms | AOS1; SUA1; UBLE1A; HSPC140 |
Gene ID | 10055 |
mRNA Refseq | NM_005500.3 |
Protein Refseq | NP_005491.1 |
MIM | 613294 |
UniProt ID | Q9UBE0 |
◆ Recombinant Proteins | ||
SAE1-104H | Active Recombinant Human SAE1/SAE2 | +Inquiry |
SAE1-255H | Recombinant Human SAE1, GST-tagged | +Inquiry |
SAE1-170H | Active Recombinant Human SAE1/UBA2, GST/His-tagged | +Inquiry |
SAE1-292Z | Recombinant Zebrafish SAE1 | +Inquiry |
SAE1-691H | Recombinant Human SUMO1 Activating Enzyme Subunit 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAE1-001HCL | Recombinant Human SAE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAE1 Products
Required fields are marked with *
My Review for All SAE1 Products
Required fields are marked with *
0
Inquiry Basket