Active Recombinant Full Length Human SERPINB2 Protein, C-Flag-tagged

Cat.No. : SERPINB2-345HFL
Product Overview : Recombinant Full Length Human SERPINB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : In vivo treatment (intracerebral)
Molecular Mass : 46.4 kDa
AA Sequence : MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein
Full Length : Full L.
Gene Name SERPINB2 serpin family B member 2 [ Homo sapiens (human) ]
Official Symbol SERPINB2
Synonyms PAI; PAI2; PAI-2; PLANH2; HsT1201
Gene ID 5055
mRNA Refseq NM_002575.3
Protein Refseq NP_002566.1
MIM 173390
UniProt ID P05120

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB2 Products

Required fields are marked with *

My Review for All SERPINB2 Products

Required fields are marked with *

0
cart-icon