Active Recombinant Full Length Human SOX9 Protein, C-Flag-tagged
Cat.No. : | SOX9-175HFL |
Product Overview : | Recombinant Full Length Human SOX9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA assay |
Molecular Mass : | 56 kDa |
AA Sequence : | MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFP VCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLG KLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQAD SPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSS DVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP QTHSPQHWEQPVYTQLTRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Full Length : | Full L. |
Gene Name | SOX9 SRY-box transcription factor 9 [ Homo sapiens (human) ] |
Official Symbol | SOX9 |
Synonyms | CMD1; SRA1; CMPD1; SRXX2; SRXY10 |
Gene ID | 6662 |
mRNA Refseq | NM_000346.4 |
Protein Refseq | NP_000337.1 |
MIM | 608160 |
UniProt ID | P48436 |
◆ Recombinant Proteins | ||
SOX9-5854C | Recombinant Chicken SOX9 | +Inquiry |
SOX9-4232R | Recombinant Rhesus Macaque SOX9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX9-30696TH | Recombinant Human SOX9 | +Inquiry |
SOX9-3043H | Recombinant Human SOX9 Protein, MYC/DDK-tagged | +Inquiry |
SOX9-6261HF | Recombinant Full Length Human SOX9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX9-1555HCL | Recombinant Human SOX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOX9 Products
Required fields are marked with *
My Review for All SOX9 Products
Required fields are marked with *
0
Inquiry Basket