Active Recombinant Full Length Human SPOP Protein, C-Flag-tagged
Cat.No. : | SPOP-527HFL |
Product Overview : | Recombinant Full Length Human SPOP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | MS digestion standard |
Molecular Mass : | 42 kDa |
AA Sequence : | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA EAYRSLASAQCPFLGPPRKRLKQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SPOP speckle type BTB/POZ protein [ Homo sapiens (human) ] |
Official Symbol | SPOP |
Synonyms | TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF |
Gene ID | 8405 |
mRNA Refseq | NM_001007229.1 |
Protein Refseq | NP_001007230.1 |
MIM | 602650 |
UniProt ID | O43791 |
◆ Recombinant Proteins | ||
SPOP-2992H | Recombinant Human Speckle-type POZ Protein, T7-tagged | +Inquiry |
SPOP-2088H | Recombinant Human SPOP Protein, His (Fc)-Avi-tagged | +Inquiry |
SPOP-4258R | Recombinant Rhesus Macaque SPOP Protein, His (Fc)-Avi-tagged | +Inquiry |
SPOP-15920M | Recombinant Mouse SPOP Protein | +Inquiry |
Spop-6105M | Recombinant Mouse Spop Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPOP-1501HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
SPOP-1502HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPOP Products
Required fields are marked with *
My Review for All SPOP Products
Required fields are marked with *
0
Inquiry Basket