Recombinant Full Length Human SPOP Protein, GST Tagged
| Cat.No. : | SPOP-358HFL |
| Product Overview : | Human SPOP full-length ORF ( NP_001007227.1, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-374aa |
| Description : | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. |
| Tag : | N-GST |
| Molecular Mass : | 68.5 kDa |
| AA Sequence : | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
| Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPOP speckle type BTB/POZ protein [ Homo sapiens (human) ] |
| Official Symbol | SPOP |
| Synonyms | SPOP; speckle type BTB/POZ protein; TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF; speckle-type POZ protein; HIB homolog 1; roadkill homolog 1 |
| Gene ID | 8405 |
| mRNA Refseq | NM_001007226 |
| Protein Refseq | NP_001007227 |
| MIM | 602650 |
| UniProt ID | O43791 |
| ◆ Recombinant Proteins | ||
| SPOP-15920M | Recombinant Mouse SPOP Protein | +Inquiry |
| SPOP-4442R | Recombinant Rhesus monkey SPOP Protein, His-tagged | +Inquiry |
| Spop-6105M | Recombinant Mouse Spop Protein, Myc/DDK-tagged | +Inquiry |
| SPOP-358HFL | Recombinant Full Length Human SPOP Protein, GST Tagged | +Inquiry |
| SPOP-2992H | Recombinant Human Speckle-type POZ Protein, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPOP-1502HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
| SPOP-1501HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPOP Products
Required fields are marked with *
My Review for All SPOP Products
Required fields are marked with *
