Recombinant Full Length Human SPOP Protein, GST Tagged
Cat.No. : | SPOP-358HFL |
Product Overview : | Human SPOP full-length ORF ( NP_001007227.1, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-374aa |
Description : | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. |
Tag : | N-GST |
Molecular Mass : | 68.5 kDa |
AA Sequence : | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPOP speckle type BTB/POZ protein [ Homo sapiens (human) ] |
Official Symbol | SPOP |
Synonyms | SPOP; speckle type BTB/POZ protein; TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF; speckle-type POZ protein; HIB homolog 1; roadkill homolog 1 |
Gene ID | 8405 |
mRNA Refseq | NM_001007226 |
Protein Refseq | NP_001007227 |
MIM | 602650 |
UniProt ID | O43791 |
◆ Recombinant Proteins | ||
SPOP-3506H | Recombinant Human SPOP, His-tagged | +Inquiry |
SPOP-358HFL | Recombinant Full Length Human SPOP Protein, GST Tagged | +Inquiry |
SPOP-8670M | Recombinant Mouse SPOP Protein, His (Fc)-Avi-tagged | +Inquiry |
SPOP-4442R | Recombinant Rhesus monkey SPOP Protein, His-tagged | +Inquiry |
SPOP-2929H | Recombinant Human SPOP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPOP-1501HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
SPOP-1502HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPOP Products
Required fields are marked with *
My Review for All SPOP Products
Required fields are marked with *
0
Inquiry Basket