Recombinant Full Length Human SPOP Protein, GST Tagged

• Cat.No.: SPOP-358HFL
• Product Overview: Human SPOP full-length ORF ( NP_001007227.1, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-374aa
• Description: This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.
• Tag: N-GST
• Molecular Mass: 68.5 kDa
• AA Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPOP speckle type BTB/POZ protein [ Homo sapiens (human) ]
• Official Symbol: SPOP
• Synonyms: SPOP; speckle type BTB/POZ protein; TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF; speckle-type POZ protein; HIB homolog 1; roadkill homolog 1
• Gene ID: 8405
• mRNA Refseq: NM_001007226
• Protein Refseq: NP_001007227
• MIM: 602650
• UniProt ID: O43791