Recombinant Full Length Human SPOP Protein, GST Tagged

Cat.No. : SPOP-358HFL
Product Overview : Human SPOP full-length ORF ( NP_001007227.1, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-374aa
Description : This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein.
Tag : N-GST
Molecular Mass : 68.5 kDa
AA Sequence : MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPOP speckle type BTB/POZ protein [ Homo sapiens (human) ]
Official Symbol SPOP
Synonyms SPOP; speckle type BTB/POZ protein; TEF2; BTBD32; NSDVS1; NSDVS2; NEDMACE; NEDMIDF; speckle-type POZ protein; HIB homolog 1; roadkill homolog 1
Gene ID 8405
mRNA Refseq NM_001007226
Protein Refseq NP_001007227
MIM 602650
UniProt ID O43791

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPOP Products

Required fields are marked with *

My Review for All SPOP Products

Required fields are marked with *

0
cart-icon
0
compare icon