Active Recombinant Full Length Human TBX19 Protein, C-Flag-tagged
Cat.No. : | TBX19-658HFL |
Product Overview : | Recombinant Full Length Human TBX19 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISpot |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRM FPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPI SFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYN PFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCE HYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGP SPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST WTAVASHPFAGWGGPGAGGHHSPSSLDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TBX19 T-box transcription factor 19 [ Homo sapiens (human) ] |
Official Symbol | TBX19 |
Synonyms | TPIT; TBS19; dJ747L4.1 |
Gene ID | 9095 |
mRNA Refseq | NM_005149.3 |
Protein Refseq | NP_005140.1 |
MIM | 604614 |
UniProt ID | O60806 |
◆ Recombinant Proteins | ||
TBX19-16527M | Recombinant Mouse TBX19 Protein | +Inquiry |
TBX19-658HFL | Active Recombinant Full Length Human TBX19 Protein, C-Flag-tagged | +Inquiry |
Tbx19-6319M | Recombinant Mouse Tbx19 Protein, Myc/DDK-tagged | +Inquiry |
TBX19-9059M | Recombinant Mouse TBX19 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBX19-4873H | Recombinant Human TBX19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX19-1203HCL | Recombinant Human TBX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBX19 Products
Required fields are marked with *
My Review for All TBX19 Products
Required fields are marked with *
0
Inquiry Basket