Active Recombinant Full Length Human TFAP2A Protein, C-Flag-tagged
Cat.No. : | TFAP2A-402HFL |
Product Overview : | Recombinant Full Length Human TFAP2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA reaction positive control |
Molecular Mass : | 47 kDa |
AA Sequence : | MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHV NDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGD LSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPG RLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANV TLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDR SPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNA KSSDKEEKHRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | TFAP2A transcription factor AP-2 alpha [ Homo sapiens (human) ] |
Official Symbol | TFAP2A |
Synonyms | AP-2; BOFS; AP2TF; TFAP2; AP-2alpha |
Gene ID | 7020 |
mRNA Refseq | NM_001032280.3 |
Protein Refseq | NP_001027451.1 |
MIM | 107580 |
UniProt ID | P05549 |
◆ Recombinant Proteins | ||
TFAP2A-27355TH | Recombinant Human TFAP2A | +Inquiry |
TFAP2A-402HFL | Active Recombinant Full Length Human TFAP2A Protein, C-Flag-tagged | +Inquiry |
TFAP2A-2176H | Recombinant Human TFAP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAP2A-6651C | Recombinant Chicken TFAP2A | +Inquiry |
Tfap2a-6374M | Recombinant Mouse Tfap2a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAP2A-664HCL | Recombinant Human TFAP2A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAP2A Products
Required fields are marked with *
My Review for All TFAP2A Products
Required fields are marked with *
0
Inquiry Basket