Active Recombinant Full Length Human TRAF6 Protein, C-Flag-tagged
Cat.No. : | TRAF6-105HFL |
Product Overview : | Recombinant Full Length Human TRAF6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from, members of the TNF receptor superfamily. This protein mediates signaling from members of the TNF receptor superfamily as well as the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. This protein also interacts with the transforming growth factor (TGF) beta receptor complex and is required for Smad-independent activation of the JNK and p38 kinases. This protein has an amino terminal RING domain which is followed by four zinc-finger motifs, a central coiled-coil region and a highly conserved carboxyl terminal domain, known as the TRAF-C domain. Two alternatively spliced transcript variants, encoding an identical protein, have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate Pull-down assay |
Molecular Mass : | 59.4 kDa |
AA Sequence : | MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYEC PICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCL HKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPL ANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSL SVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCN GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKD DTLLVRCEVSTRFDMGSLRREGFQPRSTDAGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, Toll-like receptor signaling pathway, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | TRAF6 TNF receptor associated factor 6 [ Homo sapiens (human) ] |
Official Symbol | TRAF6 |
Synonyms | RNF85; MGC:3310 |
Gene ID | 7189 |
mRNA Refseq | NM_004620.4 |
Protein Refseq | NP_004611.1 |
MIM | 602355 |
UniProt ID | Q9Y4K3 |
◆ Recombinant Proteins | ||
TRAF6-17291M | Recombinant Mouse TRAF6 Protein | +Inquiry |
TRAF6-6512H | Recombinant Human TRAF6 Protein (Gln348-Asp504), N-His tagged | +Inquiry |
TRAF6-3521H | Recombinant Human TRAF6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRAF6-9560M | Recombinant Mouse TRAF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF6-105HFL | Active Recombinant Full Length Human TRAF6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF6-818HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
TRAF6-817HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF6 Products
Required fields are marked with *
My Review for All TRAF6 Products
Required fields are marked with *