Active Recombinant Full Length Human TSSK2 Protein, C-Flag-tagged

Cat.No. : TSSK2-784HFL
Product Overview : Recombinant Full Length Human TSSK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : TSSK2 activity verified in a biochemical assay: TSSK2 (testis-specific serine kinase 2) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK2 is a serine/threonine kinase that is highly expressed in testis and may be involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. Varying concentrations of TSSK2 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
Molecular Mass : 40.8 kDa
AA Sequence : MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG
AEVGKASTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Protein Kinase
Full Length : Full L.
Gene Name TSSK2 testis specific serine kinase 2 [ Homo sapiens (human) ]
Official Symbol TSSK2
Synonyms TSK2; DGS-G; SPOGA2; STK22B
Gene ID 23617
mRNA Refseq NM_053006.5
Protein Refseq NP_443732.3
MIM 610710
UniProt ID Q96PF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSSK2 Products

Required fields are marked with *

My Review for All TSSK2 Products

Required fields are marked with *

0
cart-icon