Active Recombinant Human Adiponectin, C1Q And Collagen Domain Containing

• Cat.No.: ADIPOQ-490H
• Product Overview: Recombinant Human adiponectin, C1Q and collagen domain containing encoding the human Adiponectin protein sequence (containing the signal peptide sequence, and the mature Adiponectin sequence) was expressed in modifiedhuman 293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: Adiponectin is a member of the 'adipocytokines' that are cytokines that are expressed from adipose tissues. Its general functions include regulation of energy homeostasis, hematopoiesis, inflammation and immunity.
• Amino Acid Sequence: ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
• Molecular Mass: Adiponectin migrates as a broad band between 25 and 35 kDa in SDS-PAGE due to post-translational modifications, in particular glycosylation.
• pI: Adiponectin separates into a number of glycoforms with an observed pI between 4.5 and 8.0 on 2D PAGE due to post-translational modifications, in particular glycosylation.
• % Carbohydrate: Purified Adiponectin consists of 0 to 30% carbohydrate by weight.
• Glycosylation: Adiponectin contains O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED50 of adiponectinB is typically 3-5 ug/ml as measured by its ability to inhibit M1 cell proliferation.

Gene Information

• Gene Name: ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ]
• Synonyms: ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; APM1
• Gene ID: 9370
• mRNA Refseq: NM_004797
• Protein Refseq: NP_004788
• UniProt ID: Q15848
• Chromosome Location: 3q27
• MIM: 605441
• Pathway: Adipocytokine signaling pathway; PPAR signaling pathway; ligand-receptor interaction; Type II diabetes mellitus
• Function: cytokine activity; eukaryotic cell surface binding; growth factor activity; protein homodimerization activity