Recombinant Horse ADIPOQ protein
Cat.No. : | ADIPOQ-4633H |
Product Overview : | Recombinant Horse ADIPOQ protein(F7DZE7)(18-244aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 18-244aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAVLFTYDQYQDKNLDQASGSVLLYLEKGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
◆ Recombinant Proteins | ||
Adipoq-79M | Active Recombinant Mouse Adipoq, FLAG-tagged | +Inquiry |
Adipoq-5443R | Recombinant Rat Adiponectin, C1Q And Collagen Domain Containing | +Inquiry |
Adipoq-195R | Recombinant Rat Adipoq, FLAG-tagged | +Inquiry |
ADIPOQ-45H | Recombinant Human ADIPOQ, Flag-tagged | +Inquiry |
ADIPOQ-2646D | Recombinant Dog ADIPOQ Protein, His-GST-tagged | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *